Anti HMBOX1 pAb (ATL-HPA058586)

Atlas Antibodies

SKU: ATL-HPA058586-25

• 
• 

Product Description

Protein Description: homeobox containing 1
Gene Name: HMBOX1
Alternative Gene Name: FLJ21616, HNF1LA, HOT1, PBHNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021972: 97%, ENSRNOG00000013326: 95%
Entrez Gene ID: 79618
Uniprot ID: Q6NT76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVV
• Gene Sequence: SPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVV
• Gene ID - Mouse: ENSMUSG00000021972
• Gene ID - Rat: ENSRNOG00000013326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links