Anti HLTF pAb (ATL-HPA049001)

Atlas Antibodies

SKU:
ATL-HPA049001-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: helicase-like transcription factor
Gene Name: HLTF
Alternative Gene Name: HIP116A, HLTF1, RNF80, SMARCA3, SNF2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002428: 81%, ENSRNOG00000000082: 83%
Entrez Gene ID: 6596
Uniprot ID: Q14527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVV
Gene Sequence MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVV
Gene ID - Mouse ENSMUSG00000002428
Gene ID - Rat ENSRNOG00000000082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HLTF pAb (ATL-HPA049001)
Datasheet Anti HLTF pAb (ATL-HPA049001) Datasheet (External Link)
Vendor Page Anti HLTF pAb (ATL-HPA049001) at Atlas Antibodies

Documents & Links for Anti HLTF pAb (ATL-HPA049001)
Datasheet Anti HLTF pAb (ATL-HPA049001) Datasheet (External Link)
Vendor Page Anti HLTF pAb (ATL-HPA049001)