Protein Description: major histocompatibility complex, class II, DM beta
Gene Name: HLA-DMB
Alternative Gene Name: D6S221E, RING7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037548: 76%, ENSRNOG00000049491: 72%
Entrez Gene ID: 3109
Uniprot ID: P28068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HLA-DMB
Alternative Gene Name: D6S221E, RING7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037548: 76%, ENSRNOG00000049491: 72%
Entrez Gene ID: 3109
Uniprot ID: P28068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL |
| Documents & Links for Anti HLA-DMB pAb (ATL-HPA077524) | |
| Datasheet | Anti HLA-DMB pAb (ATL-HPA077524) Datasheet (External Link) |
| Vendor Page | Anti HLA-DMB pAb (ATL-HPA077524) at Atlas |
| Documents & Links for Anti HLA-DMB pAb (ATL-HPA077524) | |
| Datasheet | Anti HLA-DMB pAb (ATL-HPA077524) Datasheet (External Link) |
| Vendor Page | Anti HLA-DMB pAb (ATL-HPA077524) |