Anti HLA-DMB pAb (ATL-HPA077524)

Atlas Antibodies

SKU: ATL-HPA077524-25

• 

Protein Description: major histocompatibility complex, class II, DM beta
Gene Name: HLA-DMB
Alternative Gene Name: D6S221E, RING7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037548: 76%, ENSRNOG00000049491: 72%
Entrez Gene ID: 3109
Uniprot ID: P28068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL
• Gene Sequence: YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL
• Gene ID - Mouse: ENSMUSG00000037548
• Gene ID - Rat: ENSRNOG00000049491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.