Protein Description: hexokinase domain containing 1
Gene Name: HKDC1
Alternative Gene Name: FLJ22761, FLJ37767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020080: 84%, ENSRNOG00000049045: 89%
Entrez Gene ID: 80201
Uniprot ID: Q2TB90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HKDC1
Alternative Gene Name: FLJ22761, FLJ37767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020080: 84%, ENSRNOG00000049045: 89%
Entrez Gene ID: 80201
Uniprot ID: Q2TB90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIRGNGTELFEYVADCLADFMKTKDLKHKK |
| Documents & Links for Anti HKDC1 pAb (ATL-HPA064198) | |
| Datasheet | Anti HKDC1 pAb (ATL-HPA064198) Datasheet (External Link) |
| Vendor Page | Anti HKDC1 pAb (ATL-HPA064198) at Atlas |
| Documents & Links for Anti HKDC1 pAb (ATL-HPA064198) | |
| Datasheet | Anti HKDC1 pAb (ATL-HPA064198) Datasheet (External Link) |
| Vendor Page | Anti HKDC1 pAb (ATL-HPA064198) |