Anti HIVEP1 pAb (ATL-HPA050724)

Atlas Antibodies

SKU:
ATL-HPA050724-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in subset glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: human immunodeficiency virus type I enhancer binding protein 1
Gene Name: HIVEP1
Alternative Gene Name: CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021366: 50%, ENSRNOG00000014460: 52%
Entrez Gene ID: 3096
Uniprot ID: P15822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATLPTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQ
Gene Sequence SHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATLPTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQ
Gene ID - Mouse ENSMUSG00000021366
Gene ID - Rat ENSRNOG00000014460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIVEP1 pAb (ATL-HPA050724)
Datasheet Anti HIVEP1 pAb (ATL-HPA050724) Datasheet (External Link)
Vendor Page Anti HIVEP1 pAb (ATL-HPA050724) at Atlas Antibodies

Documents & Links for Anti HIVEP1 pAb (ATL-HPA050724)
Datasheet Anti HIVEP1 pAb (ATL-HPA050724) Datasheet (External Link)
Vendor Page Anti HIVEP1 pAb (ATL-HPA050724)