Protein Description: histone cluster 1, H1t
Gene Name: HIST1H1T
Alternative Gene Name: H1FT, H1t
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036211: 55%, ENSRNOG00000061863: 57%
Entrez Gene ID: 3010
Uniprot ID: P22492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HIST1H1T
Alternative Gene Name: H1FT, H1t
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036211: 55%, ENSRNOG00000061863: 57%
Entrez Gene ID: 3010
Uniprot ID: P22492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS |
Documents & Links for Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) | |
Datasheet | Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) at Atlas |
Documents & Links for Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) | |
Datasheet | Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) |