Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA068266-25

• 

Product Description

Protein Description: histone cluster 1, H1t
Gene Name: HIST1H1T
Alternative Gene Name: H1FT, H1t
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036211: 55%, ENSRNOG00000061863: 57%
Entrez Gene ID: 3010
Uniprot ID: P22492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS
• Gene Sequence: SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS
• Gene ID - Mouse: ENSMUSG00000036211
• Gene ID - Rat: ENSRNOG00000061863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links