Anti HIRA pAb (ATL-HPA052902)

Atlas Antibodies

SKU:
ATL-HPA052902-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: histone cell cycle regulator
Gene Name: HIRA
Alternative Gene Name: DGCR1, TUP1, TUPLE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022702: 97%, ENSRNOG00000049255: 95%
Entrez Gene ID: 7290
Uniprot ID: P54198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTG
Gene Sequence TWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTG
Gene ID - Mouse ENSMUSG00000022702
Gene ID - Rat ENSRNOG00000049255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HIRA pAb (ATL-HPA052902)
Datasheet Anti HIRA pAb (ATL-HPA052902) Datasheet (External Link)
Vendor Page Anti HIRA pAb (ATL-HPA052902) at Atlas Antibodies

Documents & Links for Anti HIRA pAb (ATL-HPA052902)
Datasheet Anti HIRA pAb (ATL-HPA052902) Datasheet (External Link)
Vendor Page Anti HIRA pAb (ATL-HPA052902)