Protein Description: hypoxia inducible factor 1, alpha subunit inhibitor
Gene Name: HIF1AN
Alternative Gene Name: DKFZp762F1811, FIH1, FLJ20615, FLJ22027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036450: 96%, ENSRNOG00000014234: 97%
Entrez Gene ID: 55662
Uniprot ID: Q9NWT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HIF1AN
Alternative Gene Name: DKFZp762F1811, FIH1, FLJ20615, FLJ22027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036450: 96%, ENSRNOG00000014234: 97%
Entrez Gene ID: 55662
Uniprot ID: Q9NWT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI |
| Documents & Links for Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) | |
| Datasheet | Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) at Atlas |
| Documents & Links for Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) | |
| Datasheet | Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) |