Anti HHLA2 pAb (ATL-HPA055478 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055478-25

• 
• 

Protein Description: HERV-H LTR-associating 2
Gene Name: HHLA2
Alternative Gene Name: B7H7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035914: 32%, ENSRNOG00000033608: 33%
Entrez Gene ID: 11148
Uniprot ID: Q9UM44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL
• Gene Sequence: IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL
• Gene ID - Mouse: ENSMUSG00000035914
• Gene ID - Rat: ENSRNOG00000033608
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HHLA2 pAb (ATL-HPA055478 w/enhanced validation) – 4 Found

Yan, Han; Qiu, Wanglong; Koehne de Gonzalez, Anne K; Wei, Ji-Shu; Tu, Min; Xi, Chun-Hua; Yang, Ye-Ran; Peng, Yun-Peng; Tsai, Wei-Yann; Remotti, Helen E; Miao, Yi; Su, Gloria H. HHLA2 is a novel immune checkpoint protein in pancreatic ductal adenocarcinoma and predicts post-surgical survival. Cancer Letters. 2019;442( 30447255):333-340. 

Qi, Yangzhi; Deng, Gang; Xu, Pengfei; Zhang, Huikai; Yuan, Fanen; Geng, Rongxin; Jiang, Hongxiang; Liu, Baohui; Chen, Qianxue. HHLA2 is a novel prognostic predictor and potential therapeutic target in malignant glioma. Oncology Reports. 2019;42(6):2309-2322. 

Zhou, Qiang-Hua; Li, Kai-Wen; Chen, Xu; He, Hai-Xia; Peng, Sheng-Meng; Peng, Shi-Rong; Wang, Qiong; Li, Ze-An; Tao, Yi-Ran; Cai, Wen-Li; Liu, Ran-Yi; Huang, Hai. HHLA2 and PD-L1 co-expression predicts poor prognosis in patients with clear cell renal cell carcinoma. Journal For Immunotherapy Of Cancer. 2020;8(1) 

Huang, Fu-Xue; Wu, Jun-Wan; Cheng, Xia-Qin; Wang, Jiu-Hong; Wen, Xi-Zhi; Li, Jing-Jing; Zhang, Qiong; Jiang, Hang; Ding, Qiu-Yue; Zhu, Xiao-Feng; Zhang, Xiao-Shi; Ding, Ya; Li, Dan-Dan. HHLA2 predicts improved prognosis of anti-PD-1/PD-L1 immunotherapy in patients with melanoma. Frontiers In Immunology. 13( 36003385):902167.