Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058279-25
  • Immunohistochemical staining of human colon, kidney, liver and soft tissues using Anti-HGFAC antibody HPA058279 (A) shows similar protein distribution across tissues to independent antibody HPA059076 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: HGF activator
Gene Name: HGFAC
Alternative Gene Name: HGFA, HGFAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029102: 80%, ENSRNOG00000009572: 83%
Entrez Gene ID: 3083
Uniprot ID: Q04756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DERPWCYVVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIG
Gene Sequence DERPWCYVVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIG
Gene ID - Mouse ENSMUSG00000029102
Gene ID - Rat ENSRNOG00000009572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation)
Datasheet Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation)
Datasheet Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HGFAC pAb (ATL-HPA058279 w/enhanced validation)