Anti HGD pAb (ATL-HPA047374 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047374-100
  • Immunohistochemistry analysis in human liver and tonsil tissues using Anti-HGD antibody. Corresponding HGD RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-HGD antibody HPA047374 (A) shows similar pattern to independent antibody HPA052359 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: homogentisate 1,2-dioxygenase
Gene Name: HGD
Alternative Gene Name: AKU, HGO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022821: 93%, ENSRNOG00000002701: 94%
Entrez Gene ID: 3081
Uniprot ID: Q93099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPP
Gene Sequence QVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPP
Gene ID - Mouse ENSMUSG00000022821
Gene ID - Rat ENSRNOG00000002701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HGD pAb (ATL-HPA047374 w/enhanced validation)
Datasheet Anti HGD pAb (ATL-HPA047374 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HGD pAb (ATL-HPA047374 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HGD pAb (ATL-HPA047374 w/enhanced validation)
Datasheet Anti HGD pAb (ATL-HPA047374 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HGD pAb (ATL-HPA047374 w/enhanced validation)



Citations for Anti HGD pAb (ATL-HPA047374 w/enhanced validation) – 1 Found
Nguyen, Tran N; Nguyen, Ha Q; Le, Duc-Hau. Unveiling prognostics biomarkers of tyrosine metabolism reprogramming in liver cancer by cross-platform gene expression analyses. Plos One. 15(6):e0229276.  PubMed