Anti HFE pAb (ATL-HPA053470)

Atlas Antibodies

SKU:
ATL-HPA053470-100
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: hemochromatosis
Gene Name: HFE
Alternative Gene Name: HLA-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006611: 72%, ENSRNOG00000016967: 75%
Entrez Gene ID: 3077
Uniprot ID: Q30201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWE
Gene Sequence LGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWE
Gene ID - Mouse ENSMUSG00000006611
Gene ID - Rat ENSRNOG00000016967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HFE pAb (ATL-HPA053470)
Datasheet Anti HFE pAb (ATL-HPA053470) Datasheet (External Link)
Vendor Page Anti HFE pAb (ATL-HPA053470) at Atlas Antibodies

Documents & Links for Anti HFE pAb (ATL-HPA053470)
Datasheet Anti HFE pAb (ATL-HPA053470) Datasheet (External Link)
Vendor Page Anti HFE pAb (ATL-HPA053470)