Anti HEXB pAb (ATL-HPA056010 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056010-25
  • Immunohistochemical staining of human cerebral cortex, lung, prostate and testis using Anti-HEXB antibody HPA056010 (A) shows similar protein distribution across tissues to independent antibody HPA055409 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: hexosaminidase B (beta polypeptide)
Gene Name: HEXB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021665: 72%, ENSRNOG00000025274: 69%
Entrez Gene ID: 3074
Uniprot ID: P07686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVW
Gene Sequence FGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVW
Gene ID - Mouse ENSMUSG00000021665
Gene ID - Rat ENSRNOG00000025274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HEXB pAb (ATL-HPA056010 w/enhanced validation)
Datasheet Anti HEXB pAb (ATL-HPA056010 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HEXB pAb (ATL-HPA056010 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HEXB pAb (ATL-HPA056010 w/enhanced validation)
Datasheet Anti HEXB pAb (ATL-HPA056010 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HEXB pAb (ATL-HPA056010 w/enhanced validation)