Anti HDAC4 pAb (ATL-HPA048723)

Atlas Antibodies

SKU: ATL-HPA048723-25

• 

Protein Description: histone deacetylase 4
Gene Name: HDAC4
Alternative Gene Name: BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA, KIAA0288
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026313: 91%, ENSRNOG00000020372: 93%
Entrez Gene ID: 9759
Uniprot ID: P56524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
• Gene Sequence: QDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKL
• Gene ID - Mouse: ENSMUSG00000026313
• Gene ID - Rat: ENSRNOG00000020372
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.