Anti HCFC1R1 pAb (ATL-HPA059647)

Atlas Antibodies

SKU: ATL-HPA059647-25

• 
• 

Protein Description: host cell factor C1 regulator 1 (XPO1 dependent)
Gene Name: HCFC1R1
Alternative Gene Name: FLJ20568, HPIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023904: 49%, ENSRNOG00000003542: 46%
Entrez Gene ID: 54985
Uniprot ID: Q9NWW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN
• Gene Sequence: QPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEEN
• Gene ID - Mouse: ENSMUSG00000023904
• Gene ID - Rat: ENSRNOG00000003542
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.