Protein Description: hemoglobin subunit zeta
Gene Name: HBZ
Alternative Gene Name: HBZ-T1, HBZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055609: 71%, ENSRNOG00000020536: 69%
Entrez Gene ID: 3050
Uniprot ID: P02008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HBZ
Alternative Gene Name: HBZ-T1, HBZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055609: 71%, ENSRNOG00000020536: 69%
Entrez Gene ID: 3050
Uniprot ID: P02008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY |
| Documents & Links for Anti HBZ pAb (ATL-HPA071726) | |
| Datasheet | Anti HBZ pAb (ATL-HPA071726) Datasheet (External Link) |
| Vendor Page | Anti HBZ pAb (ATL-HPA071726) at Atlas |
| Documents & Links for Anti HBZ pAb (ATL-HPA071726) | |
| Datasheet | Anti HBZ pAb (ATL-HPA071726) Datasheet (External Link) |
| Vendor Page | Anti HBZ pAb (ATL-HPA071726) |