Anti HAUS3 pAb (ATL-HPA048190)

Atlas Antibodies

SKU: ATL-HPA048190-25

• 

Protein Description: HAUS augmin-like complex, subunit 3
Gene Name: HAUS3
Alternative Gene Name: C4orf15, dgt3, IT1, MGC4701
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079555: 85%, ENSRNOG00000015255: 82%
Entrez Gene ID: 79441
Uniprot ID: Q68CZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLK
• Gene Sequence: MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLK
• Gene ID - Mouse: ENSMUSG00000079555
• Gene ID - Rat: ENSRNOG00000015255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.