Anti HARBI1 pAb (ATL-HPA045457)

Atlas Antibodies

SKU:
ATL-HPA045457-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane & cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: harbinger transposase derived 1
Gene Name: HARBI1
Alternative Gene Name: C11orf77, FLJ32675
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027243: 86%, ENSRNOG00000043204: 91%
Entrez Gene ID: 283254
Uniprot ID: Q96MB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSV
Gene Sequence NCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSV
Gene ID - Mouse ENSMUSG00000027243
Gene ID - Rat ENSRNOG00000043204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HARBI1 pAb (ATL-HPA045457)
Datasheet Anti HARBI1 pAb (ATL-HPA045457) Datasheet (External Link)
Vendor Page Anti HARBI1 pAb (ATL-HPA045457) at Atlas Antibodies

Documents & Links for Anti HARBI1 pAb (ATL-HPA045457)
Datasheet Anti HARBI1 pAb (ATL-HPA045457) Datasheet (External Link)
Vendor Page Anti HARBI1 pAb (ATL-HPA045457)