Anti HAPLN2 pAb (ATL-HPA045765 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045765-100

• 
• 

Protein Description: hyaluronan and proteoglycan link protein 2
Gene Name: HAPLN2
Alternative Gene Name: BRAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004894: 94%, ENSRNOG00000018870: 94%
Entrez Gene ID: 60484
Uniprot ID: Q9GZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
• Gene Sequence: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
• Gene ID - Mouse: ENSMUSG00000004894
• Gene ID - Rat: ENSRNOG00000018870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.