Polyclonal Antibody against Human HAND1, Gene description: heart and neural crest derivatives expressed 1, Alternative Gene Names: bHLHa27, eHand, Hxt, Thing1, Validated applications: ICC, Uniprot ID: O96004, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications |
| Application |
ICC |
| Reactivity |
Human |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene Sequence |
HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP |
| Gene ID - Mouse |
ENSMUSG00000037335 |
| Gene ID - Rat |
ENSMUSG00000037335 |
| Buffer |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
