Anti-HAND1 pAb (ATL-HPA075313)

Catalog No:
ATL-HPA075313-100
$596.00
Polyclonal Antibody against Human HAND1, Gene description: heart and neural crest derivatives expressed 1, Alternative Gene Names: bHLHa27, eHand, Hxt, Thing1, Validated applications: ICC, Uniprot ID: O96004, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence HPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFP
Gene ID - Mouse ENSMUSG00000037335
Gene ID - Rat ENSMUSG00000037335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-HAND1 pAb (ATL-HPA075313)
Vendor Page Anti-HAND1 pAb (ATL-HPA075313) at Atlas

Documents & Links for Anti-HAND1 pAb (ATL-HPA075313)
Vendor Page Anti-HAND1 pAb (ATL-HPA075313)