Anti HADHB pAb (ATL-HPA066099 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066099-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis using Anti-HADHB antibody HPA066099 (A) shows similar pattern to independent antibody HPA037539 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Gene Name: HADHB
Alternative Gene Name: MTPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059447: 84%, ENSRNOG00000010800: 81%
Entrez Gene ID: 3032
Uniprot ID: P55084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
Gene Sequence LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI
Gene ID - Mouse ENSMUSG00000059447
Gene ID - Rat ENSRNOG00000010800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HADHB pAb (ATL-HPA066099 w/enhanced validation)
Datasheet Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HADHB pAb (ATL-HPA066099 w/enhanced validation)
Datasheet Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HADHB pAb (ATL-HPA066099 w/enhanced validation)