Anti HADHB pAb (ATL-HPA066099 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA066099-25
- Shipping:
- Calculated at Checkout
$447.00
Product Description
Protein Description: hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Gene Name: HADHB
Alternative Gene Name: MTPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059447: 84%, ENSRNOG00000010800: 81%
Entrez Gene ID: 3032
Uniprot ID: P55084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HADHB
Alternative Gene Name: MTPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059447: 84%, ENSRNOG00000010800: 81%
Entrez Gene ID: 3032
Uniprot ID: P55084
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI |
Gene Sequence | LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI |
Gene ID - Mouse | ENSMUSG00000059447 |
Gene ID - Rat | ENSRNOG00000010800 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) | |
Datasheet | Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) | |
Datasheet | Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HADHB pAb (ATL-HPA066099 w/enhanced validation) |