Anti HADHA pAb (ATL-HPA056070)

Atlas Antibodies

SKU:
ATL-HPA056070-100
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Gene Name: HADHA
Alternative Gene Name: GBP, LCEH, LCHAD, MTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025745: 86%, ENSRNOG00000024629: 85%
Entrez Gene ID: 3030
Uniprot ID: P40939
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK
Gene Sequence DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK
Gene ID - Mouse ENSMUSG00000025745
Gene ID - Rat ENSRNOG00000024629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HADHA pAb (ATL-HPA056070)
Datasheet Anti HADHA pAb (ATL-HPA056070) Datasheet (External Link)
Vendor Page Anti HADHA pAb (ATL-HPA056070) at Atlas Antibodies

Documents & Links for Anti HADHA pAb (ATL-HPA056070)
Datasheet Anti HADHA pAb (ATL-HPA056070) Datasheet (External Link)
Vendor Page Anti HADHA pAb (ATL-HPA056070)