Anti HACE1 pAb (ATL-HPA046071)

Atlas Antibodies

SKU: ATL-HPA046071-25

• 

Protein Description: HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
Gene Name: HACE1
Alternative Gene Name: KIAA1320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038822: 97%, ENSRNOG00000000327: 97%
Entrez Gene ID: 57531
Uniprot ID: Q8IYU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTT
• Gene Sequence: PVNENDILLVHRDSIFRSSCEVVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTT
• Gene ID - Mouse: ENSMUSG00000038822
• Gene ID - Rat: ENSRNOG00000000327
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.