Anti H2BFWT pAb (ATL-HPA056289)
Atlas Antibodies
- SKU:
- ATL-HPA056289-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: H2BFWT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027829: 34%, ENSRNOG00000053285: 39%
Entrez Gene ID: 158983
Uniprot ID: Q7Z2G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL |
Gene Sequence | PKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVL |
Gene ID - Mouse | ENSMUSG00000027829 |
Gene ID - Rat | ENSRNOG00000053285 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti H2BFWT pAb (ATL-HPA056289) | |
Datasheet | Anti H2BFWT pAb (ATL-HPA056289) Datasheet (External Link) |
Vendor Page | Anti H2BFWT pAb (ATL-HPA056289) at Atlas Antibodies |
Documents & Links for Anti H2BFWT pAb (ATL-HPA056289) | |
Datasheet | Anti H2BFWT pAb (ATL-HPA056289) Datasheet (External Link) |
Vendor Page | Anti H2BFWT pAb (ATL-HPA056289) |