Anti H1FNT pAb (ATL-HPA046204)

Atlas Antibodies

SKU: ATL-HPA046204-25

• 

Protein Description: H1 histone family, member N, testis-specific
Gene Name: H1FNT
Alternative Gene Name: H1T2, HANP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048077: 47%, ENSRNOG00000029545: 48%
Entrez Gene ID: 341567
Uniprot ID: Q75WM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS
• Gene Sequence: MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS
• Gene ID - Mouse: ENSMUSG00000048077
• Gene ID - Rat: ENSRNOG00000029545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.