Protein Description: granzyme A
Gene Name: GZMA
Alternative Gene Name: CTLA3, HFSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023132: 71%, ENSRNOG00000010603: 71%
Entrez Gene ID: 3001
Uniprot ID: P12544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GZMA
Alternative Gene Name: CTLA3, HFSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023132: 71%, ENSRNOG00000010603: 71%
Entrez Gene ID: 3001
Uniprot ID: P12544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKG |
Gene ID - Mouse | ENSMUSG00000023132 |
Gene ID - Rat | ENSMUSG00000023132 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GZMA pAb (ATL-HPA076751 w/enhanced validation) | |
Datasheet | Anti GZMA pAb (ATL-HPA076751 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GZMA pAb (ATL-HPA076751 w/enhanced validation) at Atlas |
Documents & Links for Anti GZMA pAb (ATL-HPA076751 w/enhanced validation) | |
Datasheet | Anti GZMA pAb (ATL-HPA076751 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GZMA pAb (ATL-HPA076751 w/enhanced validation) |