Anti GUCY1A3 pAb (ATL-HPA058617)

Atlas Antibodies

SKU: ATL-HPA058617-25

• 

Protein Description: guanylate cyclase 1 soluble subunit alpha
Gene Name: GUCY1A3
Alternative Gene Name: GC-SA3, GUC1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033910: 84%, ENSRNOG00000012302: 84%
Entrez Gene ID: 2982
Uniprot ID: Q02108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
• Gene Sequence: PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
• Gene ID - Mouse: ENSMUSG00000033910
• Gene ID - Rat: ENSRNOG00000012302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.