Anti GUCY1A3 pAb (ATL-HPA058617)

Atlas Antibodies

SKU:
ATL-HPA058617-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: guanylate cyclase 1 soluble subunit alpha
Gene Name: GUCY1A3
Alternative Gene Name: GC-SA3, GUC1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033910: 84%, ENSRNOG00000012302: 84%
Entrez Gene ID: 2982
Uniprot ID: Q02108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
Gene Sequence PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR
Gene ID - Mouse ENSMUSG00000033910
Gene ID - Rat ENSRNOG00000012302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GUCY1A3 pAb (ATL-HPA058617)
Datasheet Anti GUCY1A3 pAb (ATL-HPA058617) Datasheet (External Link)
Vendor Page Anti GUCY1A3 pAb (ATL-HPA058617) at Atlas Antibodies

Documents & Links for Anti GUCY1A3 pAb (ATL-HPA058617)
Datasheet Anti GUCY1A3 pAb (ATL-HPA058617) Datasheet (External Link)
Vendor Page Anti GUCY1A3 pAb (ATL-HPA058617)