Anti GUCY1A3 pAb (ATL-HPA056004)

Atlas Antibodies

SKU:
ATL-HPA056004-25
  • Immunohistochemical staining of human parathyroid gland shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: guanylate cyclase 1, soluble, alpha 3
Gene Name: GUCY1A3
Alternative Gene Name: GC-SA3, GUC1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033910: 85%, ENSRNOG00000012302: 85%
Entrez Gene ID: 2982
Uniprot ID: Q02108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLM
Gene Sequence NSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLM
Gene ID - Mouse ENSMUSG00000033910
Gene ID - Rat ENSRNOG00000012302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GUCY1A3 pAb (ATL-HPA056004)
Datasheet Anti GUCY1A3 pAb (ATL-HPA056004) Datasheet (External Link)
Vendor Page Anti GUCY1A3 pAb (ATL-HPA056004) at Atlas Antibodies

Documents & Links for Anti GUCY1A3 pAb (ATL-HPA056004)
Datasheet Anti GUCY1A3 pAb (ATL-HPA056004) Datasheet (External Link)
Vendor Page Anti GUCY1A3 pAb (ATL-HPA056004)