Anti GTSF1L pAb (ATL-HPA054694 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054694-25

• 

Protein Description: gametocyte specific factor 1-like
Gene Name: GTSF1L
Alternative Gene Name: C20orf65, dJ1028D15.4, FAM112A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070708: 86%, ENSRNOG00000036830: 73%
Entrez Gene ID: 149699
Uniprot ID: Q9H1H1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDT
• Gene Sequence: MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDT
• Gene ID - Mouse: ENSMUSG00000070708
• Gene ID - Rat: ENSRNOG00000036830
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.