Anti GTPBP8 pAb (ATL-HPA058631)
Atlas Antibodies
- SKU:
- ATL-HPA058631-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GTPBP8
Alternative Gene Name: HSPC135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022668: 92%, ENSRNOG00000002044: 91%
Entrez Gene ID: 29083
Uniprot ID: Q8N3Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIKALFSLAPEVEVRVSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMVETYLKERRNL |
Gene Sequence | LIKALFSLAPEVEVRVSKKPGHTKKMNFFKVGKHFTVVDMPGYGFRAPEDFVDMVETYLKERRNL |
Gene ID - Mouse | ENSMUSG00000022668 |
Gene ID - Rat | ENSRNOG00000002044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GTPBP8 pAb (ATL-HPA058631) | |
Datasheet | Anti GTPBP8 pAb (ATL-HPA058631) Datasheet (External Link) |
Vendor Page | Anti GTPBP8 pAb (ATL-HPA058631) at Atlas Antibodies |
Documents & Links for Anti GTPBP8 pAb (ATL-HPA058631) | |
Datasheet | Anti GTPBP8 pAb (ATL-HPA058631) Datasheet (External Link) |
Vendor Page | Anti GTPBP8 pAb (ATL-HPA058631) |