Anti GTF3C1 pAb (ATL-HPA051617)

Atlas Antibodies

SKU:
ATL-HPA051617-25
  • Immunohistochemical staining of human salivary gland shows strong nuclear and cyoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIIC, polypeptide 1, alpha 220kDa
Gene Name: GTF3C1
Alternative Gene Name: TFIIIC220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032777: 87%, ENSRNOG00000016218: 87%
Entrez Gene ID: 2975
Uniprot ID: Q12789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVFIFLKKNAVIVDTTICDPHYNLARSSRPFERRLYVLNSMQDVENYWFDLQCVCLNTPLGVVRCPRVRKNSSTDQGSDEEGSLQKEQESAMDKHNLERKCAMLEYTTGSREVVDEGLIPGDGLGAAGLDSSFYG
Gene Sequence QVFIFLKKNAVIVDTTICDPHYNLARSSRPFERRLYVLNSMQDVENYWFDLQCVCLNTPLGVVRCPRVRKNSSTDQGSDEEGSLQKEQESAMDKHNLERKCAMLEYTTGSREVVDEGLIPGDGLGAAGLDSSFYG
Gene ID - Mouse ENSMUSG00000032777
Gene ID - Rat ENSRNOG00000016218
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF3C1 pAb (ATL-HPA051617)
Datasheet Anti GTF3C1 pAb (ATL-HPA051617) Datasheet (External Link)
Vendor Page Anti GTF3C1 pAb (ATL-HPA051617) at Atlas Antibodies

Documents & Links for Anti GTF3C1 pAb (ATL-HPA051617)
Datasheet Anti GTF3C1 pAb (ATL-HPA051617) Datasheet (External Link)
Vendor Page Anti GTF3C1 pAb (ATL-HPA051617)