Anti GTF2H2 pAb (ATL-HPA047001)

Atlas Antibodies

SKU:
ATL-HPA047001-100
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIH, polypeptide 2, 44kDa
Gene Name: GTF2H2
Alternative Gene Name: BTF2, BTF2P44, p44, T-BTF2P44, TFIIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021639: 97%, ENSRNOG00000018230: 96%
Entrez Gene ID: 2966
Uniprot ID: Q13888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Gene Sequence HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Gene ID - Mouse ENSMUSG00000021639
Gene ID - Rat ENSRNOG00000018230
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2H2 pAb (ATL-HPA047001)
Datasheet Anti GTF2H2 pAb (ATL-HPA047001) Datasheet (External Link)
Vendor Page Anti GTF2H2 pAb (ATL-HPA047001) at Atlas Antibodies

Documents & Links for Anti GTF2H2 pAb (ATL-HPA047001)
Datasheet Anti GTF2H2 pAb (ATL-HPA047001) Datasheet (External Link)
Vendor Page Anti GTF2H2 pAb (ATL-HPA047001)