Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA061626-25
  • Immunohistochemistry analysis in human gallbladder and pancreas tissues using Anti-GTF2B antibody. Corresponding GTF2B RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & nuclear bodies.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GTF2B antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: general transcription factor IIB
Gene Name: GTF2B
Alternative Gene Name: TFIIB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028271: 99%, ENSRNOG00000011135: 85%
Entrez Gene ID: 2959
Uniprot ID: Q00403
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPRDTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFG
Gene Sequence LPRDTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFG
Gene ID - Mouse ENSMUSG00000028271
Gene ID - Rat ENSRNOG00000011135
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation)
Datasheet Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation)
Datasheet Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GTF2B pAb (ATL-HPA061626 w/enhanced validation)