Anti GSTO2 pAb (ATL-HPA048141)

Atlas Antibodies

SKU: ATL-HPA048141-100

• 
• 
• 

Protein Description: glutathione S-transferase omega 2
Gene Name: GSTO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025069: 77%, ENSRNOG00000012801: 79%
Entrez Gene ID: 119391
Uniprot ID: Q9H4Y5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFG
• Gene Sequence: DVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFG
• Gene ID - Mouse: ENSMUSG00000025069
• Gene ID - Rat: ENSRNOG00000012801
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GSTO2 pAb (ATL-HPA048141) – 3 Found

Hamilton, Lauren E; Acteau, Genevieve; Xu, Wei; Sutovsky, Peter; Oko, Richard. The developmental origin and compartmentalization of glutathione-s-transferase omega 2 isoforms in the perinuclear theca of eutherian spermatozoa. Biology Of Reproduction. 2017;97(4):612-621. 

Sumiya, Ryusuke; Terayama, Masayoshi; Hagiwara, Teruki; Nakata, Kazuaki; Sekihara, Keigo; Nagasaka, Satoshi; Miyazaki, Hideki; Igari, Toru; Yamada, Kazuhiko; Kawamura, Yuki I. Loss of GSTO2 contributes to cell growth and mitochondria function via the p38 signaling in lung squamous cell carcinoma. Cancer Science. 2022;113(1):195-204. 

Hamilton, Lauren E; Zigo, Michal; Mao, Jiude; Xu, Wei; Sutovsky, Peter; O'Flaherty, Cristian; Oko, Richard. GSTO2 Isoforms Participate in the Oxidative Regulation of the Plasmalemma in Eutherian Spermatozoa during Capacitation. Antioxidants (Basel, Switzerland). 2019;8(12)