Protein Description: glutathione-disulfide reductase
Gene Name: GSR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031584: 84%, ENSRNOG00000014915: 86%
Entrez Gene ID: 2936
Uniprot ID: P00390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GSR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031584: 84%, ENSRNOG00000014915: 86%
Entrez Gene ID: 2936
Uniprot ID: P00390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVD |
| Documents & Links for Anti GSR pAb (ATL-HPA064806) | |
| Datasheet | Anti GSR pAb (ATL-HPA064806) Datasheet (External Link) |
| Vendor Page | Anti GSR pAb (ATL-HPA064806) at Atlas |
| Documents & Links for Anti GSR pAb (ATL-HPA064806) | |
| Datasheet | Anti GSR pAb (ATL-HPA064806) Datasheet (External Link) |
| Vendor Page | Anti GSR pAb (ATL-HPA064806) |