Anti GSN pAb (ATL-HPA054026)
Atlas Antibodies
- SKU:
- ATL-HPA054026-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: GSN
Alternative Gene Name: DKFZp313L0718
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026879: 91%, ENSRNOG00000018991: 92%
Entrez Gene ID: 2934
Uniprot ID: P06396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR |
| Gene Sequence | AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR |
| Gene ID - Mouse | ENSMUSG00000026879 |
| Gene ID - Rat | ENSRNOG00000018991 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GSN pAb (ATL-HPA054026) | |
| Datasheet | Anti GSN pAb (ATL-HPA054026) Datasheet (External Link) |
| Vendor Page | Anti GSN pAb (ATL-HPA054026) at Atlas Antibodies |
| Documents & Links for Anti GSN pAb (ATL-HPA054026) | |
| Datasheet | Anti GSN pAb (ATL-HPA054026) Datasheet (External Link) |
| Vendor Page | Anti GSN pAb (ATL-HPA054026) |
| Citations for Anti GSN pAb (ATL-HPA054026) – 2 Found |
| Dhar, Neha; Arsiwala, Ammar; Murali, Shruthi; Kane, Ravi S. "Trim"ming PolyQ proteins with engineered PML. Biotechnology And Bioengineering. 2020;117(2):362-371. PubMed |
| Yang, Jia-Lian; Wang, Charles C N; Cai, Jia-Hua; Chou, Che-Yi; Lin, Yu-Chao; Hung, Chin-Chuan. Identification of GSN and LAMC2 as Key Prognostic Genes of Bladder Cancer by Integrated Bioinformatics Analysis. Cancers. 2020;12(7) PubMed |