Anti GRTP1 pAb (ATL-HPA046201)

Atlas Antibodies

SKU: ATL-HPA046201-25

• 

Protein Description: growth hormone regulated TBC protein 1
Gene Name: GRTP1
Alternative Gene Name: FLJ22474, TBC1D6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038515: 83%, ENSRNOG00000061995: 89%
Entrez Gene ID: 79774
Uniprot ID: Q5TC63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR
• Gene Sequence: VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR
• Gene ID - Mouse: ENSMUSG00000038515
• Gene ID - Rat: ENSRNOG00000061995
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.