Anti GRM6 pAb (ATL-HPA014511)

Atlas Antibodies

SKU:
ATL-HPA014511-25
  • Immunohistochemical staining of human retina shows strong cytoplasmic positivity in nerve fibers.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamate receptor, metabotropic 6
Gene Name: GRM6
Alternative Gene Name: CSNB1B, GPRC1F, mGlu6, MGLUR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000617: 95%, ENSRNOG00000000233: 92%
Entrez Gene ID: 2916
Uniprot ID: O15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV
Gene Sequence VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV
Gene ID - Mouse ENSMUSG00000000617
Gene ID - Rat ENSRNOG00000000233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRM6 pAb (ATL-HPA014511)
Datasheet Anti GRM6 pAb (ATL-HPA014511) Datasheet (External Link)
Vendor Page Anti GRM6 pAb (ATL-HPA014511) at Atlas Antibodies

Documents & Links for Anti GRM6 pAb (ATL-HPA014511)
Datasheet Anti GRM6 pAb (ATL-HPA014511) Datasheet (External Link)
Vendor Page Anti GRM6 pAb (ATL-HPA014511)