Protein Description: glutamate receptor, metabotropic 6
Gene Name: GRM6
Alternative Gene Name: CSNB1B, GPRC1F, mGlu6, MGLUR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000617: 95%, ENSRNOG00000000233: 92%
Entrez Gene ID: 2916
Uniprot ID: O15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRM6
Alternative Gene Name: CSNB1B, GPRC1F, mGlu6, MGLUR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000617: 95%, ENSRNOG00000000233: 92%
Entrez Gene ID: 2916
Uniprot ID: O15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV |
Gene ID - Mouse | ENSMUSG00000000617 |
Gene ID - Rat | ENSMUSG00000000617 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GRM6 pAb (ATL-HPA014511) | |
Datasheet | Anti GRM6 pAb (ATL-HPA014511) Datasheet (External Link) |
Vendor Page | Anti GRM6 pAb (ATL-HPA014511) at Atlas |
Documents & Links for Anti GRM6 pAb (ATL-HPA014511) | |
Datasheet | Anti GRM6 pAb (ATL-HPA014511) Datasheet (External Link) |
Vendor Page | Anti GRM6 pAb (ATL-HPA014511) |