Protein Description: glutamate receptor, metabotropic 6
Gene Name: GRM6
Alternative Gene Name: CSNB1B, GPRC1F, mGlu6, MGLUR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000617: 95%, ENSRNOG00000000233: 92%
Entrez Gene ID: 2916
Uniprot ID: O15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRM6
Alternative Gene Name: CSNB1B, GPRC1F, mGlu6, MGLUR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000617: 95%, ENSRNOG00000000233: 92%
Entrez Gene ID: 2916
Uniprot ID: O15303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VMFNENGDAPGRYDIFQYQATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGV |
| Documents & Links for Anti GRM6 pAb (ATL-HPA014511) | |
| Datasheet | Anti GRM6 pAb (ATL-HPA014511) Datasheet (External Link) |
| Vendor Page | Anti GRM6 pAb (ATL-HPA014511) at Atlas |
| Documents & Links for Anti GRM6 pAb (ATL-HPA014511) | |
| Datasheet | Anti GRM6 pAb (ATL-HPA014511) Datasheet (External Link) |
| Vendor Page | Anti GRM6 pAb (ATL-HPA014511) |