Protein Description: G protein-coupled receptor kinase 7
Gene Name: GRK7
Alternative Gene Name: GPRK7
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 131890
Uniprot ID: Q8WTQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: GRK7
Alternative Gene Name: GPRK7
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 131890
Uniprot ID: Q8WTQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DPSVVYAKDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSG |
| Documents & Links for Anti GRK7 pAb (ATL-HPA075093) | |
| Datasheet | Anti GRK7 pAb (ATL-HPA075093) Datasheet (External Link) |
| Vendor Page | Anti GRK7 pAb (ATL-HPA075093) at Atlas |
| Documents & Links for Anti GRK7 pAb (ATL-HPA075093) | |
| Datasheet | Anti GRK7 pAb (ATL-HPA075093) Datasheet (External Link) |
| Vendor Page | Anti GRK7 pAb (ATL-HPA075093) |