Anti GRK4 pAb (ATL-HPA057023)

Atlas Antibodies

SKU: ATL-HPA057023-25

• 

Product Description

Protein Description: G protein-coupled receptor kinase 4
Gene Name: GRK4
Alternative Gene Name: GPRK2L, GPRK4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052783: 48%, ENSRNOG00000011847: 50%
Entrez Gene ID: 2868
Uniprot ID: P32298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ
• Gene Sequence: ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMVPSEKEVEPKQ
• Gene ID - Mouse: ENSMUSG00000052783
• Gene ID - Rat: ENSRNOG00000011847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links