Anti GRK2 pAb (ATL-HPA048330)

Atlas Antibodies

SKU: ATL-HPA048330-25

• 

Protein Description: G protein-coupled receptor kinase 2
Gene Name: GRK2
Alternative Gene Name: ADRBK1, BARK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024858: 98%, ENSRNOG00000018985: 98%
Entrez Gene ID: 156
Uniprot ID: P25098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
• Gene Sequence: LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
• Gene ID - Mouse: ENSMUSG00000024858
• Gene ID - Rat: ENSRNOG00000018985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.