Anti GRK1 pAb (ATL-HPA059376 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059376-25

• 

Product Description

Protein Description: G protein-coupled receptor kinase 1
Gene Name: GRK1
Alternative Gene Name: GPRK1, RHOK, RK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031450: 88%, ENSRNOG00000018430: 88%
Entrez Gene ID: 6011
Uniprot ID: Q15835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQL
• Gene Sequence: FRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQL
• Gene ID - Mouse: ENSMUSG00000031450
• Gene ID - Rat: ENSRNOG00000018430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links