Anti GRIPAP1 pAb (ATL-HPA000282)

Atlas Antibodies

SKU: ATL-HPA000282-25

• 

Protein Description: GRIP1 associated protein 1
Gene Name: GRIPAP1
Alternative Gene Name: DKFZp434P0630, GRASP-1, GRASP1, KIAA1167, MPMGp800B12492Q3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031153: 90%, ENSRNOG00000009071: 93%
Entrez Gene ID: 56850
Uniprot ID: Q4V328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKQCREQHAAELKGKEEELQDVRDQLEQAQEERDCHLKTISSLKQEVKDTVDGQRILEKKGSAALKDLKRQLHLERKRADKLQERLQDILTNSKSRSGLEELVLSEMNSPSRTQT
• Gene Sequence: LKQCREQHAAELKGKEEELQDVRDQLEQAQEERDCHLKTISSLKQEVKDTVDGQRILEKKGSAALKDLKRQLHLERKRADKLQERLQDILTNSKSRSGLEELVLSEMNSPSRTQT
• Gene ID - Mouse: ENSMUSG00000031153
• Gene ID - Rat: ENSRNOG00000009071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.