Anti GRID2IP pAb (ATL-HPA045381)

Atlas Antibodies

SKU: ATL-HPA045381-100

• 
• 

Protein Description: glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein
Gene Name: GRID2IP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010825: 97%, ENSRNOG00000030927: 97%
Entrez Gene ID: 392862
Uniprot ID: A4D2P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SETSHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEP
• Gene Sequence: SETSHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEP
• Gene ID - Mouse: ENSMUSG00000010825
• Gene ID - Rat: ENSRNOG00000030927
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.