Anti-GRIA4 pAb (ATL-HPA063282)

Catalog No:
ATL-HPA063282-100
$596.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Polyclonal Antibody against Human GRIA4, Gene description: glutamate ionotropic receptor AMPA type subunit 4, Alternative Gene Names: GluA4, GLUR4, GLURD, Validated applications: ICC, Uniprot ID: P48058, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence NGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGK
Gene ID - Mouse ENSMUSG00000025892
Gene ID - Rat ENSMUSG00000025892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-GRIA4 pAb (ATL-HPA063282)
Vendor Page Anti-GRIA4 pAb (ATL-HPA063282) at Atlas

Documents & Links for Anti-GRIA4 pAb (ATL-HPA063282)
Vendor Page Anti-GRIA4 pAb (ATL-HPA063282)