Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059960-25

• 
• 

Protein Description: grainyhead-like transcription factor 3
Gene Name: GRHL3
Alternative Gene Name: SOM, TFCP2L4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037188: 84%, ENSRNOG00000029427: 86%
Entrez Gene ID: 57822
Uniprot ID: Q8TE85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL
• Gene Sequence: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL
• Gene ID - Mouse: ENSMUSG00000037188
• Gene ID - Rat: ENSRNOG00000029427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GRHL3 pAb (ATL-HPA059960 w/enhanced validation) – 2 Found

Kashgari, Ghaidaa; Venkatesh, Sanan; Refuerzo, Samuel; Pham, Brandon; Bayat, Anita; Klein, Rachel Herndon; Ramos, Raul; Ta, Albert Paul; Plikus, Maksim V; Wang, Ping H; Andersen, Bogi. GRHL3 activates FSCN1 to relax cell-cell adhesions between migrating keratinocytes during wound reepithelialization. Jci Insight. 2021;6(17) 

Huang, Huaxing; Liu, Jiafeng; Li, Mingsen; Guo, Huizhen; Zhu, Jin; Zhu, Liqiong; Wu, Siqi; Mo, Kunlun; Huang, Ying; Tan, Jieying; Chen, Chaoqun; Wang, Bofeng; Yu, Yankun; Wang, Li; Liu, Yizhi; Ouyang, Hong. Cis-regulatory chromatin loops analysis identifies GRHL3 as a master regulator of surface epithelium commitment. Science Advances. 2022;8(28):eabo5668.