Anti GRAP pAb (ATL-HPA046595 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046595-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GRAP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416529).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GRB2-related adaptor protein
Gene Name: GRAP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004837: 84%, ENSRNOG00000002599: 83%
Entrez Gene ID: 10750
Uniprot ID: Q13588
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
Gene Sequence ELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
Gene ID - Mouse ENSMUSG00000004837
Gene ID - Rat ENSRNOG00000002599
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRAP pAb (ATL-HPA046595 w/enhanced validation)
Datasheet Anti GRAP pAb (ATL-HPA046595 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRAP pAb (ATL-HPA046595 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GRAP pAb (ATL-HPA046595 w/enhanced validation)
Datasheet Anti GRAP pAb (ATL-HPA046595 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRAP pAb (ATL-HPA046595 w/enhanced validation)