Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051514-25

• 
• 

Protein Description: glutamic pyruvate transaminase (alanine aminotransferase) 2
Gene Name: GPT2
Alternative Gene Name: ALT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031700: 92%, ENSRNOG00000059579: 95%
Entrez Gene ID: 84706
Uniprot ID: Q8TD30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA
• Gene Sequence: PVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLA
• Gene ID - Mouse: ENSMUSG00000031700
• Gene ID - Rat: ENSRNOG00000059579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPT2 pAb (ATL-HPA051514 w/enhanced validation) – 1 Found

Wei, Peng; Bott, Alex J; Cluntun, Ahmad A; Morgan, Jeffrey T; Cunningham, Corey N; Schell, John C; Ouyang, Yeyun; Ficarro, Scott B; Marto, Jarrod A; Danial, Nika N; DeBerardinis, Ralph J; Rutter, Jared. Mitochondrial pyruvate supports lymphoma proliferation by fueling a glutamate pyruvate transaminase 2-dependent glutaminolysis pathway. Science Advances. 2022;8(39):eabq0117.