Anti GPSM1 pAb (ATL-HPA060736)

Atlas Antibodies

SKU: ATL-HPA060736-25

• 

Product Description

Protein Description: G protein signaling modulator 1
Gene Name: GPSM1
Alternative Gene Name: AGS3, DKFZP727I051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026930: 93%, ENSRNOG00000018666: 93%
Entrez Gene ID: 26086
Uniprot ID: Q86YR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS
• Gene Sequence: RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS
• Gene ID - Mouse: ENSMUSG00000026930
• Gene ID - Rat: ENSRNOG00000018666
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links