Anti GPRC5A pAb (ATL-HPA046526)

Atlas Antibodies

SKU: ATL-HPA046526-25

• 

Protein Description: G protein-coupled receptor, class C, group 5, member A
Gene Name: GPRC5A
Alternative Gene Name: PEIG-1, RAI3, RAIG1, TIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046733: 55%, ENSRNOG00000008412: 58%
Entrez Gene ID: 9052
Uniprot ID: Q8NFJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL
• Gene Sequence: MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL
• Gene ID - Mouse: ENSMUSG00000046733
• Gene ID - Rat: ENSRNOG00000008412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.